General Information

  • ID:  hor006478
  • Uniprot ID:  Q91971
  • Protein name:  Glucagon-like peptide 1-1
  • Gene name:  gcg1
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGTYTSDVSTYLQDQAAKDFVSWLKSGRA
  • Length:  31
  • Propeptide:  MFGIHSLAGVLLLVIVQRQLASPLQEAEDNSSLETTDPLLEDLMGVSNVKRHSEGTFSNDYSKYQEERMAQDFVQWLMNSKRSGAPSKRHADGTYTSDVSTYLQDQAAKDFVSWLKSGRARRESAEESRNGPMSRRHVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSGKSNKRQEDH
  • Signal peptide:  MFGIHSLAGVLLLVIVQRQLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91971-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006478_AF2.pdbhor006478_ESM.pdb

Physical Information

Mass: 395398 Formula: C150H225N41O51
Absent amino acids: CEIMNP Common amino acids: ADS
pI: 5.54 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: -64.84 Boman Index: -6588
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 56.77
Instability Index: 1700 Extinction Coefficient cystines: 8480
Absorbance 280nm: 282.67

Literature

  • PubMed ID:  7776976
  • Title:  Trout and chicken proglucagon: alternative splicing generates mRNA transcripts encoding glucagon-like peptide 2.